Activators & Inhibitors

Piericidin B (Legacy Tebubio ref. 282T37692). Piericidin B is a bacterial metabolite that has been found inS. mobaraensisand has insecticidal and antimicrobial activities.1,2,3It inhibits NADH oxidase activity in isolated bovine heart mitochondria and inhibits respiration in isolated rat liver mitochondria and isolated cockroach (P. americana) muscle mitochondria.2,3Topical application of piericidin B (4 μg/insect) induces mortality in 87.5% of houseflies (M. domestica).1It induces 93.3, 100, and 100% mortality in rice stem borer (C. simples), silkworm (B. mori), and green caterpillar (P. rapae) larvae, respectively, when applied at respective concentrations of 60, 4.8, and 96 μg/larva. Piericidin B is active against the fungiT. asteroides,T. rubrum,M. gypseum, andC. neoforms(MICs = 20, 10, 20, and 2 μg/ml, respectively), as well as the bacteriaM. luteusandP. vulgaris(MICs = 50 and 100 μg/ml, respectively).

N-acetyl-S-geranylgeranyl-L-Cysteine (Legacy Tebubio ref. 282T37693). N-acetyl-S-geranylgeranyl-L-Cysteine is a synthetic substrate for the isoprenylated protein methyltransferase (also known as S-adenosylmethionine-dependent methyltransferase). Because it is able to serve as a substrate for the methyltransferase, it effectively functions as an inhibitor of methylation of endogenous isoprenylated proteins.

N-Acetyloxytocin (Legacy Tebubio ref. 282T37694). N-Acetyloxytocin, a chemical compound, has been identified and analyzed in the neurointermediate lobe of the rat pituitary (NIL). Furthermore, its presence has also been detected in various brain regions of the rat[1].

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ (Legacy Tebubio ref. 282T37695). NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.

NOS1-IN-1 (Legacy Tebubio ref. 282T37696). NOS1-IN-1（nNOS Inhibitor I） is a potent, selective and cell permeable nNOS inhibitor (Ki: 120 nM).NOS1-IN-1 has a Ki value of 39 μM for eNOS and 325 μM for iNOS.NOS1-IN-1 can be used for the study of neurological disorders such as cerebral palsy.

D-GsMTx4 TFA (Legacy Tebubio ref. 282T37697L). D-GsMTx4 TFA, a selective spider venom peptide, is a TRPC1/6 and Piezo2 inhibitor that inhibits cation-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families, blocks cation-selective stretch-activated channels (SACs), and attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglia reactivity. toxicity and microglia reactivity.D-GsMTx4 TFA prevented myocardial infarction in a mouse model of ischemia/reperfusion and can be used to characterize the role of excitatory MSCs in normal physiology and pathology.

OptoBI-1 (Legacy Tebubio ref. 282T37698). OptoBI-1 is a light-sensitive molecule that is photochromic TRPC3 agonist. OptoBI-1 asts as a photopharmacological tool to control of neuronal firing [1].

Org 24598 (Legacy Tebubio ref. 282T37699). Potent and selective inhibitor of the glial glycine transporter GlyT1b (IC50 = 6.9 nM). Displays negligible activity at GlyT-2, adrenoreceptors, dopamine, 5HT receptors and noradrenaline, dopamine, 5HT and GABA transporters (pIC50 in vivo.

Taraxasterol (Legacy Tebubio ref. 282T3770). Taraxasterol (Taraxasterin) is compound with anti-inflammatory activity.